Is digitalmarketingagencyreviews.co.uk cited by AI search?

digitalmarketingagencyreviews.co.uk appears 612 times in the Trakkr Citation Index across 17 unique cited pages.

612AI citations
17Unique pages cited
3Brands it appears for
-Source rank

Citation profile

digitalmarketingagencyreviews.co.uk accounts for 0.003% of AI citations Trakkr tracks. It is classified as other.

This page is generated from the public Trakkr Citation Index so crawlers can read the important facts without running JavaScript. The React page can still add richer interaction for people, but this static page gives bots the domain name, canonical URL, summary metrics, and schema in the first HTML response.

Citation metrics

MetricValueMeaning
AI citations612How many times this domain appears as a cited source in Trakkr public citation data.
Unique pages cited17How many distinct URLs from this domain appear in the citation index.
Brands it appears for3How many tracked brands are connected to this citation source.
Citation share0.003%The domain share of all citations currently represented in the slim public index.
Source categoryotherThe broad source type assigned by the citation index.
First seen2025-10-04The first timestamp this domain appeared in the current public citation dataset.

How to read this source

A citation source is a domain or page family that AI engines reference when answering prompts about brands, tools, companies, or industries. A higher citation count usually means the source is more visible inside AI-generated answers, while unique pages show whether visibility comes from one page or a broader body of content.

Use this page to understand whether digitalmarketingagencyreviews.co.uk is part of the public web evidence layer that AI systems reuse. For a brand or competitor workflow, compare citation sources with brand visibility pages, industry leaderboards, and the broader Trakkr Data citation directory.

Related Trakkr Data pages

Source: https://storage.googleapis.com/trakkr-public/research/citation-index/latest-slim.json