Is digitalmarketingagencyreviews.co.uk cited by AI search?
digitalmarketingagencyreviews.co.uk appears 612 times in the Trakkr Citation Index across 17 unique cited pages.
Citation profile
digitalmarketingagencyreviews.co.uk accounts for 0.003% of AI citations Trakkr tracks. It is classified as other.
This page is generated from the public Trakkr Citation Index so crawlers can read the important facts without running JavaScript. The React page can still add richer interaction for people, but this static page gives bots the domain name, canonical URL, summary metrics, and schema in the first HTML response.
Citation metrics
| Metric | Value | Meaning |
|---|---|---|
| AI citations | 612 | How many times this domain appears as a cited source in Trakkr public citation data. |
| Unique pages cited | 17 | How many distinct URLs from this domain appear in the citation index. |
| Brands it appears for | 3 | How many tracked brands are connected to this citation source. |
| Citation share | 0.003% | The domain share of all citations currently represented in the slim public index. |
| Source category | other | The broad source type assigned by the citation index. |
| First seen | 2025-10-04 | The first timestamp this domain appeared in the current public citation dataset. |
How to read this source
A citation source is a domain or page family that AI engines reference when answering prompts about brands, tools, companies, or industries. A higher citation count usually means the source is more visible inside AI-generated answers, while unique pages show whether visibility comes from one page or a broader body of content.
Use this page to understand whether digitalmarketingagencyreviews.co.uk is part of the public web evidence layer that AI systems reuse. For a brand or competitor workflow, compare citation sources with brand visibility pages, industry leaderboards, and the broader Trakkr Data citation directory.
Related Trakkr Data pages
- Citation source directory - Browse public domains cited by AI search results
- AI visibility rankings - See which brands are recommended most often by AI engines
- Industry leaderboards - Compare citation and visibility patterns by category